Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Pig Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

O97649

Expression Region

1-308

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPPEVPPTTAVKLLGAGTAACFADLLTFPLDTAKVRLQIQGENQAARSAQYRGVLG TILTMVRNEGPRSPYNGLVAGLQRQMSFASIRIGLYDSVKQLYTPKGSDHSSITTRILAG CTTGAMAVTCAQPTDVVKVRFQASIHAGPRSNRKYSGTMDAYRTIAREEGVRGLWKGILP NITRNAIVNCAEMVTYDVIKEKVLDYHLLTDNLPCHFVSAFGAGFCATVVASPVDVVKTR YMNSPPGQYQNPLDCMLKMVTQEGPTAFYKGFTPSFLRLGSWNVVMFVSYEQLKRALMKV QMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mlkl Antibody - C-terminal region
OAAB10571-200UL 200 µL

Mouse Mlkl Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Ursus arctos Sex-determining region Y protein (SRY)
MBS1165273-01 0.02 mg (E-Coli)

Recombinant Ursus arctos Sex-determining region Y protein (SRY)

Sign In for Pricing
View Details
Recombinant Ursus arctos Sex-determining region Y protein (SRY)
MBS1165273-02 0.1 mg (E-Coli)

Recombinant Ursus arctos Sex-determining region Y protein (SRY)

Sign In for Pricing
View Details
Recombinant Ursus arctos Sex-determining region Y protein (SRY)
MBS1165273-03 0.02 mg (Yeast)

Recombinant Ursus arctos Sex-determining region Y protein (SRY)

Sign In for Pricing
View Details
Recombinant Ursus arctos Sex-determining region Y protein (SRY)
MBS1165273-04 0.1 mg (Yeast)

Recombinant Ursus arctos Sex-determining region Y protein (SRY)

Sign In for Pricing
View Details
Recombinant Ursus arctos Sex-determining region Y protein (SRY)
MBS1165273-05 0.02 mg (Baculovirus)

Recombinant Ursus arctos Sex-determining region Y protein (SRY)

Sign In for Pricing
View Details