Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB)

This Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB) spans the amino acid sequence from region 33-340.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B4SH40

Expression Region

33-340

Origin

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTEQASTPPHDSVASVSAPTAEAAVAAHAHGEEKAGDVIMHHILDNDVFSFEPFGEVHLP KIPPIAGVDISITKHVVMLWVVSAILLILFSLVGSKYKKMTARQAPTGLVNAMEALVEFI RIDVAKANIGVGYEKYLNYLLTVFFFVLLCNLLGLVPYGATATGNINVTLTLATFTFFIT QVAALKAHGIKGYLAHLTGGTHPALWIIMIPIEFIGLFTKPVALTIRLFANMTAGHIVIL SLIFISFILQSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLSSLFIGLASAHEGHEE HEAGVAHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human regulated on activation in normal T-cell expressed and secreted, RANTES ELISA kit
YLA1515HU-01 48 Tests

Human regulated on activation in normal T-cell expressed and secreted, RANTES ELISA kit

Sign In for Pricing
View Details
Human regulated on activation in normal T-cell expressed and secreted, RANTES ELISA kit
YLA1515HU-02 96 Tests

Human regulated on activation in normal T-cell expressed and secreted, RANTES ELISA kit

Sign In for Pricing
View Details
RET Antibody
orb571256-01 50 µg

RET Antibody

Sign In for Pricing
View Details
RET Antibody
orb571256-02 100 µg

RET Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein ZIM17 (ZIM17), partial
MBS1147274 Inquire

Recombinant Saccharomyces cerevisiae Mitochondrial protein import protein ZIM17 (ZIM17), partial

Sign In for Pricing
View Details
CGI-1746 (BTK inhibitor)
SC1184-25mg 25 mg

CGI-1746 (BTK inhibitor)

Sign In for Pricing
View Details