Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB)

This Recombinant Pelodictyon phaeoclathratiforme ATP synthase subunit a (atpB) spans the amino acid sequence from region 33-340.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B4SH40

Expression Region

33-340

Origin

Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LTEQASTPPHDSVASVSAPTAEAAVAAHAHGEEKAGDVIMHHILDNDVFSFEPFGEVHLP KIPPIAGVDISITKHVVMLWVVSAILLILFSLVGSKYKKMTARQAPTGLVNAMEALVEFI RIDVAKANIGVGYEKYLNYLLTVFFFVLLCNLLGLVPYGATATGNINVTLTLATFTFFIT QVAALKAHGIKGYLAHLTGGTHPALWIIMIPIEFIGLFTKPVALTIRLFANMTAGHIVIL SLIFISFILQSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLSSLFIGLASAHEGHEE HEAGVAHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raludotatug Deruxtecan
HY-164734-01 1 mg

Raludotatug Deruxtecan

Sign In for Pricing
View Details
Raludotatug Deruxtecan
HY-164734-02 5 mg

Raludotatug Deruxtecan

Sign In for Pricing
View Details
Raludotatug Deruxtecan
HY-164734-03 10 mg

Raludotatug Deruxtecan

Sign In for Pricing
View Details
PAFR/PAF Receptor Rabbit Polyclonal Antibody
orb11225-01 50 μL

PAFR/PAF Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAFR/PAF Receptor Rabbit Polyclonal Antibody
orb11225-02 100 µL

PAFR/PAF Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAFR/PAF Receptor Rabbit Polyclonal Antibody
orb11225-03 200 µL

PAFR/PAF Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details