Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yitO (yitO)

This Recombinant Bacillus subtilis Uncharacterized protein yitO (yitO) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein yitO

UniProt

O06750

Expression Region

1-309

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLENIKQTITRWDERNPWTNVYGLARSIIALSSLLTLLINHPSLIMKPASGISSYPACKM NLSLFCLGENNYMMLNLFRWVCIAILVLVVIGWRPRITGVLHWYVSYSLQSSLIVIDGGE QAAAVMTFLLLPITLTDPRKWHWSTRPIEGKRTLGKITAFISYFVIRIQVAVLYFHSTVA KLSQQEWVDGTAVYYFAQEKTIGFNGFFQALTKPIVTSPFVVIPTWGTLLVQIVIFAALF APKKHWRLILIIAVFMHEIFAVMLGLISFSIIMAGILILYLTPIDSTIQFTYIRRLLWNK KHKKGEVSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTBDN Protein Vector (Mouse) (pPM-C-His)
PV226025 500 ng

RTBDN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human Cysteine-Rich 61 (Cyr61/Ccn1) Elisa Kit
EKC41074 96 Tests

Human Cysteine-Rich 61 (Cyr61/Ccn1) Elisa Kit

Sign In for Pricing
View Details
(S) -Ru (OAc) 2 (H8-BINAP)
sc-229269 50 mg

(S) -Ru (OAc) 2 (H8-BINAP)

Sign In for Pricing
View Details
TRNAL44P Adenovirus (Human)
48184051 1.0 mL

TRNAL44P Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Campylobacter lari Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1070896-01 1 mg (E-Coli)

Recombinant Campylobacter lari Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Recombinant Campylobacter lari Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1070896-02 1 mg (Yeast)

Recombinant Campylobacter lari Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details