Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yitO (yitO)

This Recombinant Bacillus subtilis Uncharacterized protein yitO (yitO) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein yitO

UniProt

O06750

Expression Region

1-309

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLENIKQTITRWDERNPWTNVYGLARSIIALSSLLTLLINHPSLIMKPASGISSYPACKM NLSLFCLGENNYMMLNLFRWVCIAILVLVVIGWRPRITGVLHWYVSYSLQSSLIVIDGGE QAAAVMTFLLLPITLTDPRKWHWSTRPIEGKRTLGKITAFISYFVIRIQVAVLYFHSTVA KLSQQEWVDGTAVYYFAQEKTIGFNGFFQALTKPIVTSPFVVIPTWGTLLVQIVIFAALF APKKHWRLILIIAVFMHEIFAVMLGLISFSIIMAGILILYLTPIDSTIQFTYIRRLLWNK KHKKGEVSV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA2 Antibody
orb2630975 100 µL

NCOA2 Antibody

Sign In for Pricing
View Details
DUSP1 Antibody
orb1311973 100 µL

DUSP1 Antibody

Sign In for Pricing
View Details
Dual Specificity Phosphatase 19 (DUSP19) Antibody
abx006329-01 60 µL

Dual Specificity Phosphatase 19 (DUSP19) Antibody

Sign In for Pricing
View Details
Dual Specificity Phosphatase 19 (DUSP19) Antibody
abx006329-02 120 µL

Dual Specificity Phosphatase 19 (DUSP19) Antibody

Sign In for Pricing
View Details
Dual Specificity Phosphatase 19 (DUSP19) Antibody
abx006329-03 200 µL

Dual Specificity Phosphatase 19 (DUSP19) Antibody

Sign In for Pricing
View Details
Chkb Rat siRNA Oligo Duplex (Locus ID 29367)
SR503739 1 Kit

Chkb Rat siRNA Oligo Duplex (Locus ID 29367)

Sign In for Pricing
View Details