Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2)

This Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q3SZI5

Expression Region

1-309

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPMQAAASAQYR GVLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGAGRRYQSTVEAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ARASREAPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Heme Oxygenase 1 (HO1)
TRV-0055242-01 20 µL

Polyclonal Antibody to Heme Oxygenase 1 (HO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Heme Oxygenase 1 (HO1)
TRV-0055242-02 100 µL

Polyclonal Antibody to Heme Oxygenase 1 (HO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Heme Oxygenase 1 (HO1)
TRV-0055242-03 200 µL

Polyclonal Antibody to Heme Oxygenase 1 (HO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Heme Oxygenase 1 (HO1)
TRV-0055242-04 1 mL

Polyclonal Antibody to Heme Oxygenase 1 (HO1)

Sign In for Pricing
View Details
PRPF6 Antibody
OAAF04053-100UG 100 µg

PRPF6 Antibody

Sign In for Pricing
View Details
Neurobeachin HDR Plasmid (m)
sc-424056-HDR 20 µg

Neurobeachin HDR Plasmid (m)

Sign In for Pricing
View Details