Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2)

This Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q3SZI5

Expression Region

1-309

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPMQAAASAQYR GVLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGAGRRYQSTVEAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ARASREAPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGNBP2 Rabbit Polyclonal Antibody (BF350)
orb2438525 100 µL

GGNBP2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
TNFAIP2 Rabbit Polyclonal Antibody (BF350)
orb2395403 100 µL

TNFAIP2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
CSB-E08860r-01 96 Tests

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
CSB-E08860r-02 5x 96 Tests

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details
Rat Orexin A ELISA Kit
CSB-E08860r-03 10x 96 Tests

Rat Orexin A ELISA Kit

Sign In for Pricing
View Details
C1QC Antibody, HRP conjugated
CSB-PA003641LB01HU-01 50 µg

C1QC Antibody, HRP conjugated

Sign In for Pricing
View Details