Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2)

This Recombinant Bovine Mitochondrial uncoupling protein 2 (UCP2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q3SZI5

Expression Region

1-309

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPMQAAASAQYR GVLGTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGAGRRYQSTVEAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPQAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ARASREAPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDB1 (NM_001113407) Human Tagged ORF Clone
RG225646 10 µg

LDB1 (NM_001113407) Human Tagged ORF Clone

Sign In for Pricing
View Details
C-Abl (8E9) Alexa Fluor® 546
sc-56887 AF546 200 µg/mL

C-Abl (8E9) Alexa Fluor® 546

Sign In for Pricing
View Details
CD49b (ITGA2) Human qPCR Primer Pair (NM_002203)
HP205938 200 Reactions

CD49b (ITGA2) Human qPCR Primer Pair (NM_002203)

Sign In for Pricing
View Details
Fibronectin/Ugl-Y3 Rabbit pAb
E47R13455 100 µL

Fibronectin/Ugl-Y3 Rabbit pAb

Sign In for Pricing
View Details
TTI1 Antibody
A53836-50UL 50 μL

TTI1 Antibody

Sign In for Pricing
View Details
Cox7a2l Rat siRNA Oligo Duplex (Locus ID 298762)
SR501088 1 Kit

Cox7a2l Rat siRNA Oligo Duplex (Locus ID 298762)

Sign In for Pricing
View Details