Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Mitochondrial uncoupling protein 2 (UCP2)

This Recombinant Pig Mitochondrial uncoupling protein 2 (UCP2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

O97562

Expression Region

1-309

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFKATEVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERRGPVQAAASAQYR GVLGTILTMVRNEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKHFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYRSTVDAYKTIAREEGLRGLWKGTS PNVARNAIVNCAELVTYDLIKDTLLKADLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSAPGQYSSAGHCALTMLQKEGPRAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMA ARASREAPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDE 181 [CAS:189084-67-1] 100ug/ml in Iso-octane
BDE1811ZT1 1 mL

BDE 181 [CAS:189084-67-1] 100ug/ml in Iso-octane

Sign In for Pricing
View Details
Myosin Light Chain 3 Rabbit Polyclonal Antibody
orb1741995 100 µL

Myosin Light Chain 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cluster of Differentiation 3 (CD3) Antibody (FITC)
abx413105 0.1 mg

Cluster of Differentiation 3 (CD3) Antibody (FITC)

Sign In for Pricing
View Details
Alpha Tubulin (Acetyl-Lys40) Recombinant Antibody
bsm-60706R-TR 20 µL

Alpha Tubulin (Acetyl-Lys40) Recombinant Antibody

Sign In for Pricing
View Details
CaMK2 alpha Rabbit Polyclonal Antibody (BF405)
orb1606274 100 µL

CaMK2 alpha Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA) ELISA Kit
AE25084HU-01 48 Tests

Human Receptor-type tyrosine-protein phosphatase alpha (PTPRA) ELISA Kit

Sign In for Pricing
View Details