Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia canadensis Protein translocase subunit SecF (secF)

This Recombinant Rickettsia canadensis Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

A8EXI0

Expression Region

1-310

Origin

Rickettsia canadensis (strain McKiel)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISVISIGIYKFNFGIDFVGGIVIEVRL DQTPDLPKMRQILGELGIGEVVLQNFGSERDLSIRLGSSSEANLMENIELIKASLHNNFP YKFEYRKVDFVGPQVGRQLIEAGTMAMLFSFLAIMVYIWVRFEWYFGLGILIALMHDLIL ALGFMSMTKLDCNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYYKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANKK FNNKKFNNKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C22orf28 (RTCB) activation kit by CRISPRa
GA109833 1 Kit

Human C22orf28 (RTCB) activation kit by CRISPRa

Sign In for Pricing
View Details
FOXO1A Recombinant Rabbit mAb
orb2837393-01 50 µL

FOXO1A Recombinant Rabbit mAb

Sign In for Pricing
View Details
FOXO1A Recombinant Rabbit mAb
orb2837393-02 100 µL

FOXO1A Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human GBP5 Knockout A549 cell line
GTR15417001 1 Vial

Human GBP5 Knockout A549 cell line

Sign In for Pricing
View Details
Vps35 siRNA Oligos set (Rat)
50182176 3x 5 nmol

Vps35 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Lentiviral human CGNL1 shRNA (UAS) - Lentiviral human CGNL1 shRNA (UAS, GFP) (25)
GTR15133484 1 Vial

Lentiviral human CGNL1 shRNA (UAS) - Lentiviral human CGNL1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details