Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia canadensis Protein translocase subunit SecF (secF)

This Recombinant Rickettsia canadensis Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

A8EXI0

Expression Region

1-310

Origin

Rickettsia canadensis (strain McKiel)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISVISIGIYKFNFGIDFVGGIVIEVRL DQTPDLPKMRQILGELGIGEVVLQNFGSERDLSIRLGSSSEANLMENIELIKASLHNNFP YKFEYRKVDFVGPQVGRQLIEAGTMAMLFSFLAIMVYIWVRFEWYFGLGILIALMHDLIL ALGFMSMTKLDCNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYYKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANKK FNNKKFNNKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dmrt3 Antibody
GWB-MM564F 50 µg

Dmrt3 Antibody

Sign In for Pricing
View Details
Lentiviral human CCNG2 shRNA (UAS) - Lentiviral human CCNG2 shRNA (UAS, RFP) plasmid
GTR15154945 1 Vial

Lentiviral human CCNG2 shRNA (UAS) - Lentiviral human CCNG2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
C19orf57 cDNA Clone
MBS1268996-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

C19orf57 cDNA Clone

Sign In for Pricing
View Details
C19orf57 cDNA Clone
MBS1268996-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

C19orf57 cDNA Clone

Sign In for Pricing
View Details
Rat Cyrib Pre-designed siRNA Set B
SI203507B 1 Each

Rat Cyrib Pre-designed siRNA Set B

Sign In for Pricing
View Details
Reelin Lentiviral Activation Particles (m)
sc-422644-LAC 200 µL

Reelin Lentiviral Activation Particles (m)

Sign In for Pricing
View Details