Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9A2 (OR9A2)

This Recombinant Human Olfactory receptor 9A2 (OR9A2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 9A2, Olfactory receptor OR7-2

UniProt

Q8NGT5

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCVDKRLQSPMYF FLSHLSTLEILVTTIIVPMMLWGLLFLGCRQYLSLHVSLNFSCGTMEFALLGVMAVDRYV AVCNPLRYNIIMNSSTCIWVVIVSWVFGFLSEIWPIYATFQFTFRKSNSLDHFYCDRGQL LKLSCDNTLLTEFILFLMAVFILIGSLIPTIVSYTYIISTILKIPSASGRRKAFSTFASH FTCVVIGYGSCLFLYVKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDG MKRCCQLLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRAM Rabbit pAb, AP conjugated
orb2858171 100 µL

DRAM Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Paxillin Rabbit pAb
E45R25101N-50 50 µL

Paxillin Rabbit pAb

Sign In for Pricing
View Details
Lmx1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3916105 3x 1.0 µg

Lmx1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
INTS4 (INT4, MST093, Integrator Complex Subunit 4) (MaxLight 650)
MBS6447270-01 0.1 mL

INTS4 (INT4, MST093, Integrator Complex Subunit 4) (MaxLight 650)

Sign In for Pricing
View Details
INTS4 (INT4, MST093, Integrator Complex Subunit 4) (MaxLight 650)
MBS6447270-02 5x 0.1 mL

INTS4 (INT4, MST093, Integrator Complex Subunit 4) (MaxLight 650)

Sign In for Pricing
View Details
Parvalbumin alpha
327566-01 50 µg

Parvalbumin alpha

Sign In for Pricing
View Details