Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W720

Expression Region

1-310

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSR LMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVK TRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARQNWHTPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAO1 Rabbit Polyclonal Antibody
HA500136 100 µL

GNAO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI3F9]
CF810450 100 µg

MAP126 (SPAG5) Mouse Monoclonal Antibody [Clone ID: OTI3F9]

Sign In for Pricing
View Details
Water, Ultrapure Molecular Biology Grade
#41024-4L 1x 4 L

Water, Ultrapure Molecular Biology Grade

Sign In for Pricing
View Details
Guanosine 5’-O-(2-Thiodiphosphate) Trilithium Salt
TRC-G838708-10MG 10 mg

Guanosine 5’-O-(2-Thiodiphosphate) Trilithium Salt

Sign In for Pricing
View Details
Ethylthiophosphonic Dichloride
TRC-E938668-2.5G 2.5 g

Ethylthiophosphonic Dichloride

Sign In for Pricing
View Details
C9orf41 (CARNMT1) (NM_152420) Human Over-expression Lysate
LC403480 20 µg

C9orf41 (CARNMT1) (NM_152420) Human Over-expression Lysate

Sign In for Pricing
View Details