Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W720

Expression Region

1-310

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSR LMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVK TRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARQNWHTPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GnRH (GNRH1) (11-60) Rabbit Polyclonal Antibody
AP33395PU-N 100 µg

GnRH (GNRH1) (11-60) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PATZ1 (NM_032051) Human Recombinant Protein
TP760139 50 µg

PATZ1 (NM_032051) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701084 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PRMT3 (NM_001145166) Human Over-expression Lysate
LY428738 100 µg

PRMT3 (NM_001145166) Human Over-expression Lysate

Sign In for Pricing
View Details
G3BP (G3BP1) pSer232 Rabbit Polyclonal Antibody
AP02380PU-S 50 µL

G3BP (G3BP1) pSer232 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mitofusin 1 (MFN1) Rabbit Polyclonal Antibody
TA378496 100 µL

Mitofusin 1 (MFN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details