Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W720

Expression Region

1-310

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSR LMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVK TRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARQNWHTPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide
TRC-C291910-2.5MG 2.5 mg

Chenodeoxycholic Acid 24-Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details
LCN1 (NM_002297) Human Over-expression Lysate
LY419409 100 µg

LCN1 (NM_002297) Human Over-expression Lysate

Sign In for Pricing
View Details
Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Over-expression Lysate
LY428406 100 µg

Leukotriene B4 Receptor (LTB4R) (NM_001143919) Human Over-expression Lysate

Sign In for Pricing
View Details
5 (6) -ROX cadaverine, TFA salt
#90108 1x 10 mg

5 (6) -ROX cadaverine, TFA salt

Sign In for Pricing
View Details
Tissue Protein Lysate, Esophagus
CP565657 150 µg

Tissue Protein Lysate, Esophagus

Sign In for Pricing
View Details
HA (YPYDVPDYA) -tagged Protein Purification Kit
EA-TP-K002 1Test

HA (YPYDVPDYA) -tagged Protein Purification Kit

Sign In for Pricing
View Details