Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W725

Expression Region

1-310

Origin

Cyprinus carpio (Common carp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSR LMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVK TRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARHNWATPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1 Recombinant Rabbit mAb
orb2324384-01 25 µL

PD1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PD1 Recombinant Rabbit mAb
orb2324384-02 50 µL

PD1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PD1 Recombinant Rabbit mAb
orb2324384-03 100 µL

PD1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Wbp4 (NM_018765) Mouse Recombinant Protein
E45M46832M5 20 µg

Wbp4 (NM_018765) Mouse Recombinant Protein

Sign In for Pricing
View Details
Goat Cytochrome P450 3A2 (CYP3A2) ELISA Kit
MBS9364396 Inquire

Goat Cytochrome P450 3A2 (CYP3A2) ELISA Kit

Sign In for Pricing
View Details
DHPS Peptide
DF3987-BP 1 mg

DHPS Peptide

Sign In for Pricing
View Details