Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W725

Expression Region

1-310

Origin

Cyprinus carpio (Common carp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSR LMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVK TRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARHNWATPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H (+) /Cl (-) exchange Transporter 7 (CLCN7) Human ELISA Kit
D9229 96 Tests

H (+) /Cl (-) exchange Transporter 7 (CLCN7) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human IgM FITC
MBS4517019-01 0.1 mL

Rabbit Anti-Human IgM FITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgM FITC
MBS4517019-02 0.5 mL

Rabbit Anti-Human IgM FITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgM FITC
MBS4517019-03 1 mL

Rabbit Anti-Human IgM FITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgM FITC
MBS4517019-04 5x 1 mL

Rabbit Anti-Human IgM FITC

Sign In for Pricing
View Details
Interferon alpha 17 Rabbit pAb
E47R10760 100 µL

Interferon alpha 17 Rabbit pAb

Sign In for Pricing
View Details