Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2)

This Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 2, UCP 2, Solute carrier family 25 member 8

UniProt

Q9W725

Expression Region

1-310

Origin

Cyprinus carpio (Common carp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSR LMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVK TRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARHNWATPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWA3B, CT (VWA3B, von Willebrand factor A domain-containing protein 3B) (PE)
MBS6362960-01 0.2 mL

VWA3B, CT (VWA3B, von Willebrand factor A domain-containing protein 3B) (PE)

Sign In for Pricing
View Details
VWA3B, CT (VWA3B, von Willebrand factor A domain-containing protein 3B) (PE)
MBS6362960-02 5x 0.2 mL

VWA3B, CT (VWA3B, von Willebrand factor A domain-containing protein 3B) (PE)

Sign In for Pricing
View Details
PDLIM5 Mouse Monoclonal Antibody [Clone 1H10]
E45M12440V-2 50 µL

PDLIM5 Mouse Monoclonal Antibody [Clone 1H10]

Sign In for Pricing
View Details
ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25) (PE)
247374-PE 100 µL

ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25) (PE)

Sign In for Pricing
View Details
Human CXC-chemokine ligand 17, CXCL17 ELISA KIT
E4129hu-01 48 Well

Human CXC-chemokine ligand 17, CXCL17 ELISA KIT

Sign In for Pricing
View Details
Human CXC-chemokine ligand 17, CXCL17 ELISA KIT
E4129hu-02 96 Well

Human CXC-chemokine ligand 17, CXCL17 ELISA KIT

Sign In for Pricing
View Details