Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays ADP, ATP carrier protein 2, mitochondrial (ANT2)

This Recombinant Zea mays ADP, ATP carrier protein 2, mitochondrial (ANT2) spans the amino acid sequence from region 78-387.

Product Specifications

Product Name Alternative

ADP, ATP carrier protein 2, mitochondrial, ADP/ATP translocase 2, Adenine nucleotide translocator 2, ANT 2

UniProt

P12857

Expression Region

78-387

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIADC FKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRG FNISCVGIIVYRGLYFGLYDSIKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVR RRMMMTSGEAVKYKSSLDAFQQILKKEGPKSLFKGAGANILRAIAGAGVLSGYDQLQILF FGKKYGSGGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-500 1x 500 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details