Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnetococcus sp. Protein translocase subunit SecF (secF)

This Recombinant Magnetococcus sp. Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

A0LCK8

Expression Region

1-311

Origin

Magnetococcus sp. (strain MC-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQVFLKATHFDFIGRRKPAIYASLFLIGVSLVSLFTQGLNFGIDFAGGTLIQVRFEKPMD LAPVRQAIAPLDLGDTVVQSFGTPEEVLIRVEKQGADNAAQQAIVSGVLDALKPIAGEHG VEMRRVEYVGPQVGEELTEKGMLAMLYAMVAILIYISFRFELRFALGAVLALVHDVVLTM GFFSVLQKEFTLVVVAALLTVVGYSLNDTIVVYDRIREEMKRMKRQPLATIINEAVNRTL SRTLITSLTTVLVLIALFVLGGAVIHDFALTLLFGVGIGTYSSIFVASPLVLLMDPGSRR KVAAETAEETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF5 polyclonal antibody
BS60674 50ul

IRF5 polyclonal antibody

Sign In for Pricing
View Details
LCMT2 Polyclonal Antibody
orb1418651 100 µL

LCMT2 Polyclonal Antibody

Sign In for Pricing
View Details
Eurycomanol 2-O-β-D-glucopyranoside
orb1296923-01 1 mg

Eurycomanol 2-O-β-D-glucopyranoside

Sign In for Pricing
View Details
Eurycomanol 2-O-β-D-glucopyranoside
orb1296923-02 5 mg

Eurycomanol 2-O-β-D-glucopyranoside

Sign In for Pricing
View Details
Eurycomanol 2-O-β-D-glucopyranoside
orb1296923-03 10 mg

Eurycomanol 2-O-β-D-glucopyranoside

Sign In for Pricing
View Details
Eurycomanol 2-O-β-D-glucopyranoside
orb1296923-04 1 ml x 10 mM (in DMSO)

Eurycomanol 2-O-β-D-glucopyranoside

Sign In for Pricing
View Details