Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B)

This Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b

UniProt

Q3SZE3

Expression Region

1-311

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNYKYDKAIVAESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAGLPFIIIETSTIK PYHRGFYCNDESIKYPQKTGETINDAVLTAVGIVIAILAIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLNVCNPDFSQINCSVGYIQNY RCRGEDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAF YTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPPSAIRKDMLSPV DIDRSNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal KLC1 Antibody (5C3P5)
NBP3-15712-100ul 100 µL

Rabbit Monoclonal KLC1 Antibody (5C3P5)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)
MBS1071564-01 0.02 mg (E-Coli)

Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)
MBS1071564-02 0.1 mg (E-Coli)

Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)
MBS1071564-03 0.02 mg (Yeast)

Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)
MBS1071564-04 0.1 mg (Yeast)

Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)
MBS1071564-05 0.02 mg (Baculovirus)

Recombinant Equine herpesvirus 1 Uncharacterized gene 59 protein (59)

Sign In for Pricing
View Details