Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B)

This Recombinant Bovine Lipid phosphate phosphohydrolase 3 (PPAP2B) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b

UniProt

Q3SZE3

Expression Region

1-311

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNYKYDKAIVAESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAGLPFIIIETSTIK PYHRGFYCNDESIKYPQKTGETINDAVLTAVGIVIAILAIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLNVCNPDFSQINCSVGYIQNY RCRGEDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAF YTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPPSAIRKDMLSPV DIDRSNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifi27 Rat Pre-designed siRNA Set A
HY-RS25501 1 Set

Ifi27 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (MaxLight 490)
125945-ML490 100 µL

DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (MaxLight 490)

Sign In for Pricing
View Details
CacyBP (A-10)
sc-166163 200 µg/mL

CacyBP (A-10)

Sign In for Pricing
View Details
SMURF1 Conjugated Antibody
MBS9447567-01 0.1 mL (Biotin)

SMURF1 Conjugated Antibody

Sign In for Pricing
View Details
SMURF1 Conjugated Antibody
MBS9447567-02 0.1 mL (AF350)

SMURF1 Conjugated Antibody

Sign In for Pricing
View Details
SMURF1 Conjugated Antibody
MBS9447567-03 0.1 mL (AF405)

SMURF1 Conjugated Antibody

Sign In for Pricing
View Details