Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

Q9N2I9

Expression Region

1-311

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPSEVPPTTAVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENQATQAARRIQYRG VLGTILTMVRTEGPRSPYNGLVAGLQRQMSFASIRIGLYDSVKQFYTPKGSDHSSITTRI LAGCTTGAMAVSCAQPTDVVKVRFQASIHLGAGSNRKYSGTMDAYRTIAREEGVRGLWKG TLPNITRNAIVNCAEMVTYDIIKEKLLDYHLLTDNFPCHLISAFGAGFCATVVASPVDVV KTRYMNSPPGQYCSPLDCMLKMVTQEGPTAFYKGFTPSFLRLGTWNVVMFVTYEQLKRAL MKVQMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Over-expression Lysate
LY401889 100 µg

Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Over-expression Lysate

Sign In for Pricing
View Details
Calpain 3 (CAPN3) (NM_173089) Human Recombinant Protein
TP762509 50 µg

Calpain 3 (CAPN3) (NM_173089) Human Recombinant Protein

Sign In for Pricing
View Details
S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), 0.2mg/mL
BNUB2591-100 1x 100 µL

S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), 0.2mg/mL

Sign In for Pricing
View Details
RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody
AP53565PU-N 400 µL

RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C2orf88 (NM_001042521) Human Over-expression Lysate
LY420959 100 µg

C2orf88 (NM_001042521) Human Over-expression Lysate

Sign In for Pricing
View Details
Calpastatin (CAST/1550), CF740 conjugate, 0.1mg/mL
BNC741550-100 1x 100 µL

Calpastatin (CAST/1550), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details