Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Teredinibacter turnerae ATP synthase subunit a (atpB)

This Recombinant Teredinibacter turnerae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C5BKK1

Expression Region

1-311

Origin

Teredinibacter turnerae (strain ATCC 39867 / T7901)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSETLTITDYITHHLQNMTYGKLPAGYARHHADGEVHVLEHDTWTMAHTAEEAAAMGF NAVHVDTLGWGIFLALVVGFFMRRVAVKATTDTPRGMASFIEFLVEGINGVVKDVFHHKN RLVAPMAITVFSWVFMMNLMDLIPVDWLPMAAQIVSGNEHLFFKVVPTTDPNATLGMAVT VFILMLFFSVQQKGLWGFIKELTCHPFFAPRKFWYFNLILIPFNFILETVALIAKPISLG LRLFGNLYAGEMIFILIATLFSVGLLFGFLGGILQFGWAVLHILVILIQAFVFMVLTTVY MAMAHDRHDEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KANK3 (NM_198471) Human Recombinant Protein
TP309321L 1 mg

KANK3 (NM_198471) Human Recombinant Protein

Sign In for Pricing
View Details
Ethyl Propargylate-13C3
TRC-E818062-50MG 50 mg

Ethyl Propargylate-13C3

Sign In for Pricing
View Details
Tspo (NM_009775) Mouse Tagged ORF Clone
MG201408 10 µg

Tspo (NM_009775) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DHPS Antibody
8C15330-AAT 50 µg

DHPS Antibody

Sign In for Pricing
View Details
Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein
TP314597L 1 mg

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human DCXR Protein (His Tag)
PKSH032714-01 10 µg

Recombinant Human DCXR Protein (His Tag)

Sign In for Pricing
View Details