Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein (MIR1)

This Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein (MIR1) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Mitochondrial phosphate carrier protein, Mitochondrial import receptor, Phosphate transport protein, PTP, mPic 1, p32

UniProt

P23641

Expression Region

1-311

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF KQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMG SAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQ IPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGC PPTIEIGGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL
BNC882479-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL
BNC881224-500 1x 500 µL

HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF555 conjugate, 0.1mg/mL
BNC551619-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF647 conjugate, 0.1mg/mL
BNC471782-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details