Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 121 (TMEM121)

This Recombinant Chicken Transmembrane protein 121 (TMEM121) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Transmembrane protein 121, Protein hole

UniProt

Q8QFN3

Expression Region

1-312

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLPPPDKRHVCLTTIVIMTSMAFMDAYLVEQNQGPRKIGVCIIVLVGDICFLIVLRYVA VWVGAEVKTAKRGYAMILWFLYIFVLEIKLYFIFQNYKADKKNLETVARKALTLLLSICV PGLYLVLVALDSMEYIRTFRKKEDLRGRLFWVALDLLDILDIQANLWEPHRTGLPIWAEG LMFFYCYILLLILPCVSLSEISMQGEHIAPQKMMLYPVLSLVTINIVTIFIRAINMVLFQ DSRVSTIFIGKNIIAIATKACTFLEYKRQVKEFPQNAIALELQQNSLSHNQTLHSTQGIP HEPSPTSEILDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL
BNC680201-500 1x 500 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF405S conjugate, 0.1mg/mL
BNC041041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details