Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3)

This Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3) spans the amino acid sequence from region 46-357.

Product Specifications

Product Name Alternative

Phosphate carrier protein, mitochondrial, Phosphate transport protein, PTP, Solute carrier family 25 member 3

UniProt

Q8VEM8

Expression Region

46-357

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSIT LKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSA SAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ING3 activation kit by CRISPRa
GA110179 1 Kit

Human ING3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZNF323 (ZSCAN31) activation kit by CRISPRa
GA112033 1 Kit

Human ZNF323 (ZSCAN31) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709219 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
UBE2J1 Polyclonal Antibody
E-AB-66602-01 60 µL

UBE2J1 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2J1 Polyclonal Antibody
E-AB-66602-02 120 µL

UBE2J1 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2J1 Polyclonal Antibody
E-AB-66602-03 200 µL

UBE2J1 Polyclonal Antibody

Sign In for Pricing
View Details