Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3)

This Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3) spans the amino acid sequence from region 46-357.

Product Specifications

Product Name Alternative

Phosphate carrier protein, mitochondrial, Phosphate transport protein, PTP, Solute carrier family 25 member 3

UniProt

Q8VEM8

Expression Region

46-357

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSIT LKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSA SAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF3 Human Gene Knockout Kit (CRISPR)
KN401910 1 Kit

ZNF3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL
BNC740767-500 1x 500 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF647 conjugate, 0.1mg/mL
BNC470373-100 1x 100 µL

Human IgM Immunoglobulin (IM373), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IL-37 (Interleukin 37) ELISA Kit
E-EL-H2571-01 24 Tests

Human IL-37 (Interleukin 37) ELISA Kit

Sign In for Pricing
View Details
Human IL-37 (Interleukin 37) ELISA Kit
E-EL-H2571-02 48 Tests

Human IL-37 (Interleukin 37) ELISA Kit

Sign In for Pricing
View Details
Human IL-37 (Interleukin 37) ELISA Kit
E-EL-H2571-03 96 Tests

Human IL-37 (Interleukin 37) ELISA Kit

Sign In for Pricing
View Details