Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphohydrolase 3 (Ppap2b)

This Recombinant Mouse Lipid phosphate phosphohydrolase 3 (Ppap2b) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b

UniProt

Q99JY8

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPV DIIDRNNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNA1F (NM_005183) Human Over-expression Lysate
LY417463 100 µg

CACNA1F (NM_005183) Human Over-expression Lysate

Sign In for Pricing
View Details
Adrenomedullin (AM) (1-52), human
orb1679837 1 mg

Adrenomedullin (AM) (1-52), human

Sign In for Pricing
View Details
MICAL1 (D-3) Alexa Fluor® 488
sc-515814 AF488 200 µg/mL

MICAL1 (D-3) Alexa Fluor® 488

Sign In for Pricing
View Details
MRP-L24 CRISPR Activation Plasmid (m2)
sc-426698-ACT-2 20 µg

MRP-L24 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
0.2 mL PCR 8 Tube Strips, Nature
B8RT-02N 0.2mL, Regular profile

0.2 mL PCR 8 Tube Strips, Nature

Sign In for Pricing
View Details
Anti-IMPA1  (1E6-F11)
YF-MA13807 50 ug

Anti-IMPA1 (1E6-F11)

Sign In for Pricing
View Details