Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphohydrolase 3 (Ppap2b)

This Recombinant Mouse Lipid phosphate phosphohydrolase 3 (Ppap2b) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b

UniProt

Q99JY8

Expression Region

1-312

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPV DIIDRNNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNG Mouse Monoclonal Antibody [Clone ID: CC330]
AM05875PU-N 500 µg

IFNG Mouse Monoclonal Antibody [Clone ID: CC330]

Sign In for Pricing
View Details
BMPR2 Antibody
MBS859317-01 0.1 mg

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS859317-02 0.1 mL (AF405L)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS859317-03 0.1 mL (AF405S)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS859317-04 0.1 mL (AF610)

BMPR2 Antibody

Sign In for Pricing
View Details
BMPR2 Antibody
MBS859317-05 0.1 mL (AF635)

BMPR2 Antibody

Sign In for Pricing
View Details