Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b)

This Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, Differentially expressed in rat intestine 42, Dri42, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosp

UniProt

P97544

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPV DIMDRSNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muffle Box Furnace BFMF-1000-20
BFMF-1000-20 1 Unit

Muffle Box Furnace BFMF-1000-20

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS802894 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Knee
CS709597 5x 5 µm

Tissue FFPE Sections, Knee

Sign In for Pricing
View Details
KCTD4 (NM_198404) Human Recombinant Protein
TP305394 20 µg

KCTD4 (NM_198404) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody
AN00300M-01 25 µL

Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody
AN00300M-02 100 µL

Elab Fluor® 647-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details