Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b)

This Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, Differentially expressed in rat intestine 42, Dri42, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosp

UniProt

P97544

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPV DIMDRSNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Live-or-Dye NucFixTM Red Staining Kit (200 assays)
#32010 1 Kit

Live-or-Dye NucFixTM Red Staining Kit (200 assays)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
Shpk Mouse Gene Knockout Kit (CRISPR)
KN515762 1 Kit

Shpk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AP1AR (NM_001128426) Human Over-expression Lysate
LC426954 20 µg

AP1AR (NM_001128426) Human Over-expression Lysate

Sign In for Pricing
View Details
SFRP1 Rabbit Polyclonal Antibody
ER1802-34 100 µL

SFRP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details