Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b)

This Recombinant Rat Lipid phosphate phosphohydrolase 3 (Ppap2b) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, Differentially expressed in rat intestine 42, Dri42, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosp

UniProt

P97544

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQ NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPV DIMDRSNHHNMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Foxn2 activation kit by CRISPRa
GA201437 1 Kit

Mouse Foxn2 activation kit by CRISPRa

Sign In for Pricing
View Details
DOG1 Rabbit Polyclonal Antibody
ER1901-30 100 µL

DOG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS631472 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details
SOX10 Antibody
KC-29588-01 50 μL

SOX10 Antibody

Sign In for Pricing
View Details
SOX10 Antibody
KC-29588-02 100 µL

SOX10 Antibody

Sign In for Pricing
View Details
SOX10 Antibody
KC-29588-03 1 mL

SOX10 Antibody

Sign In for Pricing
View Details