Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Human Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P55916

Expression Region

1-312

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA LMKVQMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cytokeratin 5 Antibody [Janelia Fluor 549]
NBP2-95276JF549 0.1 mL

Rabbit Polyclonal Cytokeratin 5 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Human CDS2 Recombinant Protein
PPT-11767 100 µg

Human CDS2 Recombinant Protein

Sign In for Pricing
View Details
Guinea pig Interleukin-1 beta (IL1B) ELISA kit
CSB-EL011614GU-01 48 Tests

Guinea pig Interleukin-1 beta (IL1B) ELISA kit

Sign In for Pricing
View Details
Guinea pig Interleukin-1 beta (IL1B) ELISA kit
CSB-EL011614GU-02 96 Tests

Guinea pig Interleukin-1 beta (IL1B) ELISA kit

Sign In for Pricing
View Details
Guinea pig Interleukin-1 beta (IL1B) ELISA kit
CSB-EL011614GU-03 5x 96 Tests

Guinea pig Interleukin-1 beta (IL1B) ELISA kit

Sign In for Pricing
View Details
Guinea pig Interleukin-1 beta (IL1B) ELISA kit
CSB-EL011614GU-04 10x 96 Tests

Guinea pig Interleukin-1 beta (IL1B) ELISA kit

Sign In for Pricing
View Details