Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Human Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P55916

Expression Region

1-312

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA LMKVQMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THUMPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
46681067 1.0 µg DNA

THUMPD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ccl20 Mouse Recombinant Protein
TP724708 50 µg

Ccl20 Mouse Recombinant Protein

Sign In for Pricing
View Details
C21orf91 (NM_017447) Human Recombinant Protein
TP760011 50 µg

C21orf91 (NM_017447) Human Recombinant Protein

Sign In for Pricing
View Details
Rhox3e Adenovirus (Mouse)
39549054 1.0 mL

Rhox3e Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Mucin-2 (MUC2) ELISA Kit
MBS287531-01 48 Tests

Mouse Mucin-2 (MUC2) ELISA Kit

Sign In for Pricing
View Details
Mouse Mucin-2 (MUC2) ELISA Kit
MBS287531-02 96 Tests

Mouse Mucin-2 (MUC2) ELISA Kit

Sign In for Pricing
View Details