Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Human Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P55916

Expression Region

1-312

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA LMKVQMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV669156 1.0 µg DNA

CXCR4 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PZP Polyclonal Antibody
ANT-14018-100ug 100 µg

PZP Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 R beta Antibody (03) [Allophycocyanin]
NBP3-30744APC 0.1 mL

Mouse Monoclonal IL-2 R beta Antibody (03) [Allophycocyanin]

Sign In for Pricing
View Details
CD91 Antibody
MBS9232951-01 0.1 mL

CD91 Antibody

Sign In for Pricing
View Details
CD91 Antibody
MBS9232951-02 5x 0.1 mL

CD91 Antibody

Sign In for Pricing
View Details
Klhl25 Mouse Gene Knockout Kit (CRISPR)
KN508864 1 Kit

Klhl25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details