Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yhcI (yhcI)

This Recombinant Bacillus subtilis Uncharacterized protein yhcI (yhcI) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Uncharacterized protein yhcI

UniProt

P54593

Expression Region

1-313

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNLIYNEWLKIFSRAGTWVMIGILGLTMVGFAFLANHFSAGESNSHWKQELQAQNAELK KEIKEDPSLKDGYKETITLNDYRIEHNIPSDTGYTVWSYVTDSANFTILTGLFTIIIAAG IVANEFNWGTIKLLMIRPLSRFQILMSKYITVLLFGLLLLLILFIGSTLLGLIFFGTGGE TAANIHLIYKDGHVIEQNMMGHLATTYLSESVSALMVATMAFMLSAVFRNSSLAVGFSIF LLVAGTTATAFIAAKFDWAKYILFANVDLTQYVDGTPLIKGMTMTFSLVMLAIYFIIFLL LAFGIFMKRDIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN2 siRNA (Human)
MBS8212637-01 15 nmol

ATXN2 siRNA (Human)

Sign In for Pricing
View Details
ATXN2 siRNA (Human)
MBS8212637-02 30 nmol

ATXN2 siRNA (Human)

Sign In for Pricing
View Details
ATXN2 siRNA (Human)
MBS8212637-03 5x 30 nmol

ATXN2 siRNA (Human)

Sign In for Pricing
View Details
Clu (NM_013492) Mouse Tagged Lenti ORF Clone
MR207148L4 10 µg

Clu (NM_013492) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-human NGF / bNGF (AS2886401-00 Biosimilar)
BIO0712SM-1mg 1 mg

Anti-human NGF / bNGF (AS2886401-00 Biosimilar)

Sign In for Pricing
View Details
Anti-Neutrophil Elastase/ELANE Antibody Picoband® (APC Conjugate)
PB10058-APC 100 µg/Vial

Anti-Neutrophil Elastase/ELANE Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details