Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yhcI (yhcI)

This Recombinant Bacillus subtilis Uncharacterized protein yhcI (yhcI) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Uncharacterized protein yhcI

UniProt

P54593

Expression Region

1-313

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNLIYNEWLKIFSRAGTWVMIGILGLTMVGFAFLANHFSAGESNSHWKQELQAQNAELK KEIKEDPSLKDGYKETITLNDYRIEHNIPSDTGYTVWSYVTDSANFTILTGLFTIIIAAG IVANEFNWGTIKLLMIRPLSRFQILMSKYITVLLFGLLLLLILFIGSTLLGLIFFGTGGE TAANIHLIYKDGHVIEQNMMGHLATTYLSESVSALMVATMAFMLSAVFRNSSLAVGFSIF LLVAGTTATAFIAAKFDWAKYILFANVDLTQYVDGTPLIKGMTMTFSLVMLAIYFIIFLL LAFGIFMKRDIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 1 (Flt1, VEGFR1, Vascular Endothelial Growth Factor Receptor 1)
V2110-16F1 50 µg

VEGF Receptor 1 (Flt1, VEGFR1, Vascular Endothelial Growth Factor Receptor 1)

Sign In for Pricing
View Details
Rabbit Monoclonal MCM4 Antibody (S02-8F8)
NBP3-15056-100ul 100 µL

Rabbit Monoclonal MCM4 Antibody (S02-8F8)

Sign In for Pricing
View Details
Human PABIR3 qPCR Primer Pair
QH66325S 200 Tests

Human PABIR3 qPCR Primer Pair

Sign In for Pricing
View Details
EIF1AY Rabbit Polyclonal Antibody
TA314854 100 µL

EIF1AY Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD40/TNFRSF5 Antibody (T8P2G4/A6) [DyLight 488]
NBP2-50284G 0.1 mL

Mouse Monoclonal CD40/TNFRSF5 Antibody (T8P2G4/A6) [DyLight 488]

Sign In for Pricing
View Details
Walk in fume hood (BDL-5101)
BDL-5101 1 Unit

Walk in fume hood (BDL-5101)

Sign In for Pricing
View Details