Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio vulnificus UPF0761 membrane protein VV0203 (VV0203)

This Recombinant Vibrio vulnificus UPF0761 membrane protein VV0203 (VV0203) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

UPF0761 membrane protein VV0203

UniProt

Q7MQ07

Expression Region

1-313

Origin

Vibrio vulnificus (strain YJ016)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLFGSDKLRLPQRAQAGIAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSI LSKFSVFENVGSVLQSFIINNFVPASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLI SNIDKNLNYIWRVKKKRRAVFSFSMYWMVLTLGPILVGASIAATSYITSLRLLDSEAIST VYDQLLRWLPFILSSSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWRPTEDVIQSLPNNDTEL EKDTQRDRFDSES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details