Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11)

This Recombinant Rat Mitochondrial 2-oxoglutarate/malate carrier protein (Slc25a11) spans the amino acid sequence from region 2-314.

Product Specifications

Product Name Alternative

Mitochondrial 2-oxoglutarate/malate carrier protein, OGCP, Solute carrier family 25 member 11

UniProt

P97700

Expression Region

2-314

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREY KTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVD IVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF594 conjugate, 0.1mg/mL
BNC941789-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF568 conjugate, 0.1mg/mL
BNC680485-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL
BNC741999-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details