Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate carrier protein, mitochondrial (F01G4.6)

This Recombinant Phosphate carrier protein, mitochondrial (F01G4.6) spans the amino acid sequence from region 28-340.

Product Specifications

Product Name Alternative

Phosphate carrier protein, mitochondrial, PTP

UniProt

P40614

Expression Region

28-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRT TIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAAS ASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIP YTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVS KLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPE MPASLKAKLAAQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-100 1x 100 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL
BNC402329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
BNC402984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details