Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

This Recombinant Saccharomyces cerevisiae Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

P53257

Expression Region

1-314

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM EVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS FWGYETAIHYLRMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-100 1x 100 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-100 1x 100 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details