Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Lipid phosphate phosphatase-related protein type 5 (lppr5)

This Recombinant Xenopus laevis Lipid phosphate phosphatase-related protein type 5 (lppr5) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 5, EC= 3.1.3.-

UniProt

Q6GM05

Expression Region

1-314

Origin

Xenopus laevis (African clawed frog)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFQFSLTIMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSD IPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCCYINPLVRRTVRF LGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCRQFTQFITDANACTGIPD LVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGINRV AEYRNHWSDVIAGFLIGISIAVFLVVCVVNNFKGRRTEHEHWPTENLAQMPIISIPRVEN PLEKNHLTAFAEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF488A conjugate, 0.1mg/mL
BNC881076-100 1x 100 µL

Cytokeratin, HMW (KRTH/1076), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF647 conjugate, 0.1mg/mL
BNC471967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details