Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum subsp. infantis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Bifidobacterium longum subsp. infantis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B7GRM7

Expression Region

1-315

Origin

Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLAYIPSPTFSKFEIGPFTIHMYAICILIGICVAVWILTTRWKRYGGTFDQILDTTLVT VPCALVGARLYHCITTPADYFPPTGNLVNILKVWEGGMAIFGGISVGTLVAFLWCRHKHY PFAIFADAIAPALPVAQAIGRLGNWFNQELYGWPTTLPWGLKLNDADAIGKSEICYSGAQ CPDYRTTLFHPTFLYEMIWNLIGAALIIYLGHKLADRLKAGQQFAMYLMWYGLGRTWIEN VRINYSTVILGLRTNMWTAIIVFVLGCILFVVLYQYGPDPKAQARGLAAVTADELERQSI EEERLRQKKQAKRTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL
BNC940956-100 1x 100 µL

UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF640R conjugate, 0.1mg/mL
BNC402993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF740 conjugate, 0.1mg/mL
BNC741587-500 1x 500 µL

CD62L (L-Selectin) (LAM1-116), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details