Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermococcus gammatolerans Protein translocase subunit SecF (secF)

This Recombinant Thermococcus gammatolerans Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C5A3H3

Expression Region

1-315

Origin

Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTKKQKTKKKPSDEILETKRKRLSFLVRMEPRKMVLYPLVVFLVAALILAVHFPEKGID LKGGVVVTVYHVSASPDELASYVKEKTGIDVRAEEFKDPITGLSGIRIYAPAKTAPSKIA DEISNAIRLKYKDADVTPRVVDPTFGKIAQKQGIKAVIYAFIGMAIVVFLFFRDPVPSGT IIFSAFSDMVIALATMGILGIELTTATIAALLMLIGYTVDSNILLTTRLLRRKEDTIEDA YLSAVSTGFTMSTTTLGALFILWLVSTSEVIDSITIVLIFGLLADFMNTWIFNAGVLRWY IASPLKFSIKLRRGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB32 Peptide
MBS3225664-01 0.1 mg

ZBTB32 Peptide

Sign In for Pricing
View Details
ZBTB32 Peptide
MBS3225664-02 5x 0.1 mg

ZBTB32 Peptide

Sign In for Pricing
View Details
ADAMTS20 Protein Vector (Mouse) (pPM-C-His)
PV152429 500 ng

ADAMTS20 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TNC Rabbit Polyclonal Antibody
54496-01 50 µL

TNC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNC Rabbit Polyclonal Antibody
54496-02 100 µL

TNC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DNAJA1 qPCR Primer Pair
QH16329S 200 Tests

Human DNAJA1 qPCR Primer Pair

Sign In for Pricing
View Details