Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermococcus gammatolerans Protein translocase subunit SecF (secF)

This Recombinant Thermococcus gammatolerans Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C5A3H3

Expression Region

1-315

Origin

Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTKKQKTKKKPSDEILETKRKRLSFLVRMEPRKMVLYPLVVFLVAALILAVHFPEKGID LKGGVVVTVYHVSASPDELASYVKEKTGIDVRAEEFKDPITGLSGIRIYAPAKTAPSKIA DEISNAIRLKYKDADVTPRVVDPTFGKIAQKQGIKAVIYAFIGMAIVVFLFFRDPVPSGT IIFSAFSDMVIALATMGILGIELTTATIAALLMLIGYTVDSNILLTTRLLRRKEDTIEDA YLSAVSTGFTMSTTTLGALFILWLVSTSEVIDSITIVLIFGLLADFMNTWIFNAGVLRWY IASPLKFSIKLRRGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MVD Rabbit pAb
GB115083-50 50 μL

Anti-MVD Rabbit pAb

Sign In for Pricing
View Details
FAM89A Rabbit Polyclonal Antibody
orb3068561-01 30 µL

FAM89A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM89A Rabbit Polyclonal Antibody
orb3068561-02 50 µL

FAM89A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM89A Rabbit Polyclonal Antibody
orb3068561-03 100 µL

FAM89A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM89A Rabbit Polyclonal Antibody
orb3068561-04 200 µL

FAM89A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGHMBP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1033006 1.0 µg DNA

IGHMBP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details