Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein translocase subunit SecF (secF)

This Recombinant Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

E9RGS4

Expression Region

1-315

Origin

Vibrio alginolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQILKAEKTIGFMRWSKVAFVFSIFMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEKPA NLEKIRTALDAKGFGDATVQNFGSAREVMVRLRPRDDVSGETLGNQIIGAIKDGTGESVE MRRIEFVGPNVGDELTEAGGLAILVSLICILLYVSMRFEWRLAAGAVMALAHDIIITLGV FSFLQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKGEPADIMDASITQTLSR TLITSGTTLFVVIALFMQGGAMIHGFATALLLGITVGTYSSIYVASALALKLGIQKEHLM PPQVEKEGAEFDEMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ASK1 (Ab-966) MAP3K5 Antibody
A00929-2 100 µL

Anti-ASK1 (Ab-966) MAP3K5 Antibody

Sign In for Pricing
View Details
HOXA5 for Dual Luciferase Vectors (LR-2XXXD)
LR-2104D 1 Each

HOXA5 for Dual Luciferase Vectors (LR-2XXXD)

Sign In for Pricing
View Details
Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL
BZ151-01 100 mL

Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL

Sign In for Pricing
View Details
Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL
BZ151-02 200 mL

Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL

Sign In for Pricing
View Details
Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL
BZ151-03 500 mL

Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL

Sign In for Pricing
View Details
Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL
BZ151-04 1000 mL

Artificial Perspiration, ISO 105-B07/ISO 105-E04 Acidic solution – Not Stabilized (BZ151) - 1000mL

Sign In for Pricing
View Details