Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Corynebacterium glutamicum Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q8NNU2

Expression Region

1-316

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLATIPSPPQGVWYLGPIPIRAYAMCIIAGIIVAIWLTRKRYAARGGNPEIVLDAAIVA VPAGIIGGRIYHVITDNQKYFCDTCNPVDAFKITNGGLGIWGAVILGGLAVAVFFRYKKL PLAPFADAVAPAVILAQGIGRLGNWFNQELYGAETTVPWALEIYYRVDENGKFAPVTGTS TGEVMATVHPTFLYELLWNLLIFALLMWADKRFKLGHGRVFALYVAGYTLGRFWIEQMRV DEATLIGGIRINTIVSAVVFAGAIIVFFLLKKGRETPEEVDPTFAASVAADAVASPDGKP LPKAGEGIDGETPSTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL
BNC882809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL
BNC681931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF640R conjugate, 0.1mg/mL
BNC401782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF640R conjugate, 0.1mg/mL
BNC401097-500 1x 500 µL

CD44 Standard (HCAM/1097), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (BAX/962), CF640R conjugate, 0.1mg/mL
BNC400962-100 1x 100 µL

Bax (BAX/962), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details