Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida UPF0761 membrane protein PM1616 (PM1616)

This Recombinant Pasteurella multocida UPF0761 membrane protein PM1616 (PM1616) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

UPF0761 membrane protein PM1616

UniProt

Q9CKJ9

Expression Region

1-316

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNVLKNAGLFLRLFWLRFQQNKLSQAAGYLTYSTMLALVPLVMVVFSVFSAFPVFNEVT DELKGFIFNNFAPQASDMVGQYIDEFVSNSKQMSAVGVISLVVVALMLINSIDRTLNSIW HDTTIRPLVFSFAIYWLILTLGPLLIGASIGVSSYIAAMLNENISLPFGLKILSFVPFFL TWLIFTLIYTVVPNKKVKIMHSAIGALVAAVFFTLGKQAFLWYVTTFPSYQLIYGAMATL PIMLLWIQLSWVVILIGAQLASVLADYTLCTQGKIRVEELVAADTHEPALQQKMEKTEQT LKTEITQQKQRLEKQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL36G Antibody
KC-1582-01 50 μL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1582-02 100 µL

IL36G Antibody

Sign In for Pricing
View Details
IL36G Antibody
KC-1582-03 1 mL

IL36G Antibody

Sign In for Pricing
View Details
Recombinant THO Complex Subunit 1 Antibody
RC-15173-01 50 μL

Recombinant THO Complex Subunit 1 Antibody

Sign In for Pricing
View Details
Recombinant THO Complex Subunit 1 Antibody
RC-15173-02 100 µL

Recombinant THO Complex Subunit 1 Antibody

Sign In for Pricing
View Details
Recombinant THO Complex Subunit 1 Antibody
RC-15173-03 1 mL

Recombinant THO Complex Subunit 1 Antibody

Sign In for Pricing
View Details