Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermobaculum terrenum Protein translocase subunit SecF (secF)

This Recombinant Thermobaculum terrenum Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

D1CDJ6

Expression Region

1-317

Origin

Thermobaculum terrenum (strain ATCC BAA-798 / YNP1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDIVRWRYAFYLLSLLIIIPGTIYLLLFGLRLGIDFEGGTFWQIQFEKPVRIEDVRSAL AQAGYNEAFVQSFGQQSNTAQGTVTRGVSMRLPEIKENSPEKAKLEQILKSRFGNYEELV FTSVGPAVGREIRNRSIVAIALASLGILGYIAFAFRKVSHPFRYGICAIIAMLHDVLVVV GIFAILGKHFGVEIDALFVTALLTVIGFSVHDTIVVFDRIRENQLRRYGESFEQIVNISL LQTLVRSVNTSMTVIFTLLALYFFGGTTIKHFVLALLIGIVSGTYSSIFNASLLLVSWEN KDFLRIFRRTEPEAAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1 / ROM-K) ELISA
KBH1792 1x 96 Well

GENLISA™ Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1 / ROM-K) ELISA

Sign In for Pricing
View Details
SFTPB Polyclonal Antibody
MBS9433181-01 0.05 mL

SFTPB Polyclonal Antibody

Sign In for Pricing
View Details
SFTPB Polyclonal Antibody
MBS9433181-02 0.1 mL

SFTPB Polyclonal Antibody

Sign In for Pricing
View Details
SFTPB Polyclonal Antibody
MBS9433181-03 5x 0.1 mL

SFTPB Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TNF RI/TNFRSF1A Antibody [Alexa Fluor 405]
NBP2-78785AF405 0.1 mL

Rabbit Polyclonal TNF RI/TNFRSF1A Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
CF®594 Llama Anti-Rabbit IgG (H&L), 2mg/mL
#20451-50uL 1x 50 µL

CF®594 Llama Anti-Rabbit IgG (H&L), 2mg/mL

Sign In for Pricing
View Details