Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-44 (srd-44)

This Recombinant Serpentine receptor class delta-44 (srd-44) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-44, Protein srd-44

UniProt

O17823

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKILSVLNPTVFVLSLCFQIILIYTIIRHSPKNLSTLKAILLTNCCFQLLQSSMVFFT QIQLVNHLVPIELWSYGPCRHFEAFMCYSMFHILQTSSLVSGLTVFLTTFMKYQAARHVR PSKKKNCFVILFISSIVLISAGCGILLVIIQALPLEIREKYYRINLELDEYSVIGIVDYS VLPSRVNGIIINGLVVIVPITCLLLRRKILKLLTASSDALYFQNRVFLQGLTLQIFGHTL VYVPIFICSTISLITKTEYTFAQFFIFVLPHLTTVIDPLLTMYFVTPYRKRLMVWLRLKN DKVHSVSPSTFAVSANH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAB1 Antibody
8C0237-AAT 50 µg

JAB1 Antibody

Sign In for Pricing
View Details
VASP (NM_003370) Human Over-expression Lysate
LY401150 100 µg

VASP (NM_003370) Human Over-expression Lysate

Sign In for Pricing
View Details
Diethyl 2-(4-Chlorobutyl)malonate
TRC-D187190-25G 25 g

Diethyl 2-(4-Chlorobutyl)malonate

Sign In for Pricing
View Details
Mouse Pibf1 activation kit by CRISPRa
GA205439 1 Kit

Mouse Pibf1 activation kit by CRISPRa

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), CF647 conjugate, 0.1mg/mL
BNC472256-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SIGLEC9, Tag Free (ECD)
HA211074-01 Inquire

Human SIGLEC9, Tag Free (ECD)

Sign In for Pricing
View Details